KALIOTOXIN
- 100 Kilogram / Kilograms per Month
- T/T
- 7 days
Product Description
The potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1, and 25 nM for KV1.3, KV1.1, and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
SPECIFICATION OF KALIOTOXIN
CAT | K1070-V |
CAS NO. | 145199-73-1 |
Product Name | Kaliotoxin |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 4149.89 Da |
Molecular formula | C171H283N55O49S6 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
Storage of solutions | Up to two weeks at 4C or three months at -20C. |
Sequence | GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35) |
APPLICATION OF KALIOTOXIN
Kaliotoxin (KTX), a specific blocker of potassium channels, exerts various toxic effects due to its action on the central nervous system.
As one of peptide suppliers, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about peptide library, please visit our website.
Contact Us
- Hefei KS-V Peptide Biological Technology Co., Ltd.
- Contact namedifficultpeptide
- Phone86-551-65120828
- AddressThe 11th floor,New Energy Building,Institute of Advanced Technology,USTC Hefei,Anhui
- Sliver color Hydrogen & Oxygen Inhaler 10
- Sliver color Hydrogen & Oxygen Inhaler 9
- Sliver color Hydrogen & Oxygen Inhaler 8
- Sliver color Hydrogen & Oxygen Inhaler 7
- Sliver color Hydrogen & Oxygen Inhaler 6
- Sliver color Hydrogen & Oxygen Inhaler 5
- Sliver color Hydrogen & Oxygen Inhaler 4
- Sliver color Hydrogen & Oxygen Inhaler 3
- Sliver color Hydrogen & Oxygen Inhaler 2
- Sliver color Hydrogen & Oxygen Inhaler 1
- Sliver color Hydrogen & Oxygen Inhaler
- Sliver color Hydrogen & Oxygen Inhaler
Find Similar Products By Category
- Health & Medical > Medicine > Other Medicine
- Buy on GoldSupplier.com
- How to Buy
- Browse by Catagories
- Browse by Hot Regoins
- Private Sourcing Events
- Sell on GoldSupplier.com
- How to Sell
- Post Products
- Manage Products
- Manage Groups
- About
- About Us
- Link to Us
- Contact Us
- Sitemap
- Please Enter your Email Address
- Please enter the content for your inquiry.
We will find the most reliable suppliers for you according to your description.
Send Now-
difficultpeptide
Welcome to my shop! Glad to serve you!Please send your question!
Your message has exceeded the limit.
Your message has exceeded the limit.
-
-
Your inquiry content must be between 20 to 5000 characters.Send Now.
-
Please input the mailbox.
-