MAMBALGIN 1
- 100 Kilogram / Kilograms per Month
- T/T
- 7 days
Product Description
ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2
SPECIFICATION OF MAMBALGIN 1
CAT | O1010-V |
CAS NO. | 1609937-15-6 |
Product Name | Mambalgin |
Purity | > 98% |
Form/State | Lyophilized powder |
Solubility | Soluble in water |
Molecular weight | 6554.5 Da |
Molecular formula | C272H429N85O84S10 |
Source | Synthetic peptide |
Storage | Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. |
Storage of solutions | Up to two weeks at 4C or three months at -20C. |
Sequence | LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38) |
APPLICATION OF MAMBALGIN 1
Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us.
More information about our pre clinical trial, please visit our website.
Contact Us
- Hefei KS-V Peptide Biological Technology Co., Ltd.
- Contact namedifficultpeptide
- Phone86-551-65120828
- AddressThe 11th floor,New Energy Building,Institute of Advanced Technology,USTC Hefei,Anhui
- Sliver color Hydrogen & Oxygen Inhaler 10
- Sliver color Hydrogen & Oxygen Inhaler 9
- Sliver color Hydrogen & Oxygen Inhaler 8
- Sliver color Hydrogen & Oxygen Inhaler 7
- Sliver color Hydrogen & Oxygen Inhaler 6
- Sliver color Hydrogen & Oxygen Inhaler 5
- Sliver color Hydrogen & Oxygen Inhaler 4
- Sliver color Hydrogen & Oxygen Inhaler 3
- Sliver color Hydrogen & Oxygen Inhaler 2
- Sliver color Hydrogen & Oxygen Inhaler 1
- Sliver color Hydrogen & Oxygen Inhaler
- Sliver color Hydrogen & Oxygen Inhaler
Find Similar Products By Category
- Health & Medical > Medicine > Other Medicine
- Buy on GoldSupplier.com
- How to Buy
- Browse by Catagories
- Browse by Hot Regoins
- Private Sourcing Events
- Sell on GoldSupplier.com
- How to Sell
- Post Products
- Manage Products
- Manage Groups
- About
- About Us
- Link to Us
- Contact Us
- Sitemap
- Please Enter your Email Address
- Please enter the content for your inquiry.
We will find the most reliable suppliers for you according to your description.
Send Now-
difficultpeptide
Welcome to my shop! Glad to serve you!Please send your question!
Your message has exceeded the limit.
Your message has exceeded the limit.
-
-
Your inquiry content must be between 20 to 5000 characters.Send Now.
-
Please input the mailbox.
-